PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G25400.1
Common NameBHLH118, EN5, T30C3.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 163aa    MW: 18694.6 Da    PI: 7.5729
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G25400.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.21.7e-14554455
                 HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                  h+e+E+rRR+++ s ++ Lr+llP  +   ++K s ++ ++ Av+YI +Lq
  AT4G25400.1  5 VHKEIEKRRRQEMASLYASLRSLLPLEF--IQGKRSTSDQVKGAVNYIDYLQ 54
                 6*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088812.995153IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.7E-12365IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.64E-9358No hitNo description
Gene3DG3DSA:4.10.280.102.6E-11467IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.4E-11554IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.8E-6759IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0090575Cellular ComponentRNA polymerase II transcription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MEKLVHKEIE KRRRQEMASL YASLRSLLPL EFIQGKRSTS DQVKGAVNYI DYLQRNIKDI  60
NSKRDDLVLL SGRSFRSSNE QEWNEISNHV VIRPCLVGIE IVLSILQTPF SSVLQVLREH  120
GLYVLGYICS SVNDRLIHTL QAEVNDLALI DLADLKDTLT LMK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.322610.0root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT4G25400
AtGenExpressAT4G25400
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G25400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G25400
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1426210.0AY142621.1 Arabidopsis thaliana unknown protein (At4g25400) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194270.11e-116transcription factor bHLH118
SwissprotQ9STJ71e-118BH118_ARATH; Transcription factor bHLH118
TrEMBLC0SVJ61e-116C0SVJ6_ARATH; Putative uncharacterized protein At4g25400 (Fragment)
STRINGAT4G25400.11e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Representative plantOGRP1638838
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  3. Toledo-Ortiz G,Huq E,Quail PH
    The Arabidopsis basic/helix-loop-helix transcription factor family.
    Plant Cell, 2003. 15(8): p. 1749-70
    [PMID:12897250]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Bailey PC, et al.
    Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
    Plant Cell, 2003. 15(11): p. 2497-502
    [PMID:14600211]